Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIP2A Peptide - N-terminal region

DIP2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

DIP2, C21orf106

UniProt

Q14689

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001139587.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANBP1 Human Gene Knockout Kit (CRISPR)
KN423305 1 Kit

RANBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bromodeoxyuridine (BrdU) (Proliferation Marker) (rBRD469), 1mg/mL
BNUM1538-50 1x 50 µL

Bromodeoxyuridine (BrdU) (Proliferation Marker) (rBRD469), 1mg/mL

Sign In for Pricing
View Details
Psmb8 Mouse Gene Knockout Kit (CRISPR)
KN514106 1 Kit

Psmb8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CAPZB activation kit by CRISPRa
GA100585 1 Kit

Human CAPZB activation kit by CRISPRa

Sign In for Pricing
View Details
Tigit Mouse Gene Knockout Kit (CRISPR)
KN317567LP 1 Kit

Tigit Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AATOM™ 495 azide
70223-AAT 1 mg

AATOM™ 495 azide

Sign In for Pricing
View Details