Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIP2A Peptide - N-terminal region

DIP2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

DIP2, C21orf106

UniProt

Q14689

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001139587.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Islet 2 (ISL2) activation kit by CRISPRa
GA112169 1 Kit

Human Islet 2 (ISL2) activation kit by CRISPRa

Sign In for Pricing
View Details
PDK1 (NM_001278549) Human Tagged ORF Clone
RG238334 10 µg

PDK1 (NM_001278549) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD28 (C28/74), 0.2mg/mL
BNUB0074-100 1x 100 µL

CD28 (C28/74), 0.2mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF640R conjugate, 0.1mg/mL
BNC401380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS630944 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Mouse Fadd activation kit by CRISPRa
GA201350 1 Kit

Mouse Fadd activation kit by CRISPRa

Sign In for Pricing
View Details