Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRGAP2 Peptide - middle region

SRGAP2 Peptide - middle region

Product Specifications

Product Name Alternative

FNBP2, SRGAP3, SRGAP2A, ARHGAP34

UniProt

O75044

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001164108.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (PAb1801), CF405S conjugate, 0.1mg/mL
BNC041916-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb1801), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin V-Elab Fluor® Violet 450/PI Apoptosis Kit
E-CK-A233-01 20 Assays

Annexin V-Elab Fluor® Violet 450/PI Apoptosis Kit

Sign In for Pricing
View Details
Annexin V-Elab Fluor® Violet 450/PI Apoptosis Kit
E-CK-A233-02 100 Assays

Annexin V-Elab Fluor® Violet 450/PI Apoptosis Kit

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF405S conjugate, 0.1mg/mL
BNC040045-500 1x 500 µL

Bcl-2 (100/D5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IL-4 (Interleukin 4) ELISPOT Kit
ESP-H0007-01 96 Tests

Human IL-4 (Interleukin 4) ELISPOT Kit

Sign In for Pricing
View Details
Human IL-4 (Interleukin 4) ELISPOT Kit
ESP-H0007-02 5x 96 Tests

Human IL-4 (Interleukin 4) ELISPOT Kit

Sign In for Pricing
View Details