Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHCYL2 Peptide - middle region

AHCYL2 Peptide - middle region

Product Specifications

Product Name Alternative

IRBIT2, ADOHCYASE3

UniProt

Q96HN2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001124192.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU5B-4P sgRNA CRISPR Lentivector (Human) (Target 3)
K1848404 1.0 µg DNA

RNU5B-4P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PLV2-TRE3GS-G3BP1-3xFLAG-TetOne-Blast Plasmid
PVT47697 2 µg

PLV2-TRE3GS-G3BP1-3xFLAG-TetOne-Blast Plasmid

Sign In for Pricing
View Details
MAPK3 Recombinant Protein
OPCD02972-50UG 50 µg

MAPK3 Recombinant Protein

Sign In for Pricing
View Details
GENLISA™ Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA
KBH5600 1x 96 Well

GENLISA™ Human Low Density Lipoprotein Receptor Related Protein 4 (LRP4) ELISA

Sign In for Pricing
View Details
Cis-3- (Boc-aminomethyl) cyclobutanol
SLB82792-01 0.5 g

Cis-3- (Boc-aminomethyl) cyclobutanol

Sign In for Pricing
View Details
Cis-3- (Boc-aminomethyl) cyclobutanol
SLB82792-02 5 g

Cis-3- (Boc-aminomethyl) cyclobutanol

Sign In for Pricing
View Details