Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHCYL2 Peptide - middle region

AHCYL2 Peptide - middle region

Product Specifications

Product Name Alternative

IRBIT2, ADOHCYASE3

UniProt

Q96HN2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001124192.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2IRD2 siRNA (Human)
orb1854930-01 15 nmol

GTF2IRD2 siRNA (Human)

Sign In for Pricing
View Details
GTF2IRD2 siRNA (Human)
orb1854930-02 30 nmol

GTF2IRD2 siRNA (Human)

Sign In for Pricing
View Details
Cdc50C (h) -PR
sc-78073-PR 10 µM - 20 µL

Cdc50C (h) -PR

Sign In for Pricing
View Details
Tert-Butyl 2- (4-formylphenoxy) acetate
BLA88477 2.5 g

Tert-Butyl 2- (4-formylphenoxy) acetate

Sign In for Pricing
View Details
ATG12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0142906 1.0 µg DNA

ATG12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
APC anti-Baculovirus envelope gp64
GT06577 25 µg

APC anti-Baculovirus envelope gp64

Sign In for Pricing
View Details