Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC44A1 Peptide - C-terminal region

SLC44A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD92, CTL1, CDW92, CHTL1

UniProt

Q8WWI5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001273659.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker) (NX2/2198R), CF488A conjugate, 0.1mg/mL
BNC882198-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker) (NX2/2198R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cnga2 activation kit by CRISPRa
GA200784 1 Kit

Mouse Cnga2 activation kit by CRISPRa

Sign In for Pricing
View Details
TTC39A (NM_001080494) Human Over-expression Lysate
LC421049 20 µg

TTC39A (NM_001080494) Human Over-expression Lysate

Sign In for Pricing
View Details
P-Selectin / CD62P Recombinant Rabbit monoclonal Antibody
HA723872 100 µL

P-Selectin / CD62P Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Adamts5 Mouse Gene Knockout Kit (CRISPR)
KN500862 1 Kit

Adamts5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS628954 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details