Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC44A1 Peptide - C-terminal region

SLC44A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD92, CTL1, CDW92, CHTL1

UniProt

Q8WWI5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001273659.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf3 (NM_001001701) Human Over-expression Lysate
LY424211 100 µg

C4orf3 (NM_001001701) Human Over-expression Lysate

Sign In for Pricing
View Details
Grin2a (C-term) Rabbit Polyclonal Antibody
AP26445PU-N 100 µL

Grin2a (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein
TP323658 20 µg

Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein

Sign In for Pricing
View Details
Human MIP-1β Antibody Pair Set
E-KAB-0269 50 µL & 100 µg

Human MIP-1β Antibody Pair Set

Sign In for Pricing
View Details
2-(2-Butoxyethoxy)ethyl Acetate
TRC-B695680-25ML 25 mL

2-(2-Butoxyethoxy)ethyl Acetate

Sign In for Pricing
View Details
Vmn2r10 Mouse Gene Knockout Kit (CRISPR)
KN519113 1 Kit

Vmn2r10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details