Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISCU Peptide - middle region

ISCU Peptide - middle region

Product Specifications

Product Name Alternative

HML, ISU2, NIFU, NIFUN, hnifU, 2310020H20Rik

UniProt

Q9H1K1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055116.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Sideroflexin-4(SFXN4) ELISA Kit
MBS2610346-01 48 Well

Bovine Sideroflexin-4(SFXN4) ELISA Kit

Sign In for Pricing
View Details
Bovine Sideroflexin-4(SFXN4) ELISA Kit
MBS2610346-02 96 Well

Bovine Sideroflexin-4(SFXN4) ELISA Kit

Sign In for Pricing
View Details
Bovine Sideroflexin-4(SFXN4) ELISA Kit
MBS2610346-03 5x 96 Well

Bovine Sideroflexin-4(SFXN4) ELISA Kit

Sign In for Pricing
View Details
Bovine Sideroflexin-4(SFXN4) ELISA Kit
MBS2610346-04 10x 96 Well

Bovine Sideroflexin-4(SFXN4) ELISA Kit

Sign In for Pricing
View Details
N-Heptane 99% For Synthesis
133402500 2.5 L

N-Heptane 99% For Synthesis

Sign In for Pricing
View Details
Selenocysteine Lyase (SCLY, SCL, hSCL) (PE)
133014-PE 100 µL

Selenocysteine Lyase (SCLY, SCL, hSCL) (PE)

Sign In for Pricing
View Details