Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISCU Peptide - middle region

ISCU Peptide - middle region

Product Specifications

Product Name Alternative

HML, ISU2, NIFU, NIFUN, hnifU, 2310020H20Rik

UniProt

Q9H1K1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055116.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DND1 Rabbit Polyclonal Antibody (BF350)
orb2515089 100 µL

DND1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
SPHK1 (Sphingosine Kinase 1, SPHK) (APC)
252043-APC 100 µL

SPHK1 (Sphingosine Kinase 1, SPHK) (APC)

Sign In for Pricing
View Details
1H-​2-​Benzothiopyran-​4 (3H) ​-​one 2, ​2-​dioxide
RAA72358-01 50 mg

1H-​2-​Benzothiopyran-​4 (3H) ​-​one 2, ​2-​dioxide

Sign In for Pricing
View Details
1H-​2-​Benzothiopyran-​4 (3H) ​-​one 2, ​2-​dioxide
RAA72358-02 0.5 g

1H-​2-​Benzothiopyran-​4 (3H) ​-​one 2, ​2-​dioxide

Sign In for Pricing
View Details
ZNF703 siRNA (Mouse)
MBS8225882-01 15 nmol

ZNF703 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF703 siRNA (Mouse)
MBS8225882-02 30 nmol

ZNF703 siRNA (Mouse)

Sign In for Pricing
View Details