Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A1 Peptide - C-terminal region

OR52A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HPFH1OR

UniProt

Q9UKL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036507.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTTQIRIHVVKMFCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allo Maltol
TRC-A546700-1G 1 g

Allo Maltol

Sign In for Pricing
View Details
RIT1 (NM_006912) Human Recombinant Protein
TP320552M 100 µg

RIT1 (NM_006912) Human Recombinant Protein

Sign In for Pricing
View Details
SERPING1 (NM_000062) Human Recombinant Protein
TP303767 20 µg

SERPING1 (NM_000062) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human 4-1BBL/TNFSF9 Protein (His Tag)
PKSH032023-01 20 µg

Recombinant Human 4-1BBL/TNFSF9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human 4-1BBL/TNFSF9 Protein (His Tag)
PKSH032023-02 100 µg

Recombinant Human 4-1BBL/TNFSF9 Protein (His Tag)

Sign In for Pricing
View Details
UNCX Rabbit Polyclonal Antibody
TA372077 100 µL

UNCX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details