Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A1 Peptide - C-terminal region

OR52A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HPFH1OR

UniProt

Q9UKL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036507.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTTQIRIHVVKMFCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16S V1-V3 Library Preparation Kit for Illumina
70200 24 Preparations

16S V1-V3 Library Preparation Kit for Illumina

Sign In for Pricing
View Details
Recombinant CCR7 Monoclonal Antibody
AN301736L-01 50 µL

Recombinant CCR7 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CCR7 Monoclonal Antibody
AN301736L-02 100 µL

Recombinant CCR7 Monoclonal Antibody

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Polyclonal Antibody to Human Fibronectin
BAT-2701-2 2 mL

Biotin Conjugated Rabbit Polyclonal Antibody to Human Fibronectin

Sign In for Pricing
View Details
4-(Diethylamino)azobenzene
TRC-D495010-5G 5 g

4-(Diethylamino)azobenzene

Sign In for Pricing
View Details
Cyanine 647 Alkyne
#92101 1x 1 mg

Cyanine 647 Alkyne

Sign In for Pricing
View Details