Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNE5 Peptide - N-terminal region

KCNE5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCNE1L

UniProt

Q9UJ90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036414.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTNL8 (NM_001159709) Human Over-expression Lysate
LY431331 100 µg

BTNL8 (NM_001159709) Human Over-expression Lysate

Sign In for Pricing
View Details
Ndufs4 (NM_010887) Mouse Tagged ORF Clone
MG201277 10 µg

Ndufs4 (NM_010887) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Protein Z (PROZ) Mouse Monoclonal Antibody [Clone ID: OTI1A11]
CF806740 100 µg

Protein Z (PROZ) Mouse Monoclonal Antibody [Clone ID: OTI1A11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS629704 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Collagen VI Recombinant Rabbit monoclonal Antibody
HA750305 100 µL

Collagen VI Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NOSTRIN (NM_052946) Human Over-expression Lysate
LC403273 20 µg

NOSTRIN (NM_052946) Human Over-expression Lysate

Sign In for Pricing
View Details