Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNE5 Peptide - N-terminal region

KCNE5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCNE1L

UniProt

Q9UJ90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036414.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 / Interleukin 4 (IL4/1597), Biotin conjugate, 0.1mg/mL
BNCB1597-100 1x 100 µL

IL-4 / Interleukin 4 (IL4/1597), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560435 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
ATF2 pSer112/94 Rabbit Polyclonal Antibody
AP02334PU-S 50 µL

ATF2 pSer112/94 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant WNV (lineage 2, strain Nea Santa-Greece-2010) E / Envelope Protein (Domain III, His Tag)
PKSV030262 100 µg

Recombinant WNV (lineage 2, strain Nea Santa-Greece-2010) E / Envelope Protein (Domain III, His Tag)

Sign In for Pricing
View Details
Zscan4d Mouse Gene Knockout Kit (CRISPR)
KN520158 1 Kit

Zscan4d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT11 Human Gene Knockout Kit (CRISPR)
KN219688LP 1 Kit

WNT11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details