Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA14 Peptide - N-terminal region

CA14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAXiV

UniProt

Q9ULX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036245.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL13 Protein Vector (Rat) (pPM-C-His)
PV267921 500 ng

FBXL13 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
G3BP2 Antibody
orb758538-01 25 µg

G3BP2 Antibody

Sign In for Pricing
View Details
G3BP2 Antibody
orb758538-02 50 µg

G3BP2 Antibody

Sign In for Pricing
View Details
G3BP2 Antibody
orb758538-03 100 µg

G3BP2 Antibody

Sign In for Pricing
View Details
G3BP2 Antibody
orb758538-04 200 µg

G3BP2 Antibody

Sign In for Pricing
View Details
Horse Mucin 13, Cell Surface Associated ELISA Kit
MBS077723-01 48 Well

Horse Mucin 13, Cell Surface Associated ELISA Kit

Sign In for Pricing
View Details