Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA14 Peptide - N-terminal region

CA14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAXiV

UniProt

Q9ULX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036245.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nomo1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4877903 1.0 µg DNA

Nomo1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-PYST2/DUSP7 Antibody Picoband®
A09919-1-carrier-free 100 µg/Vial

Anti-PYST2/DUSP7 Antibody Picoband®

Sign In for Pricing
View Details
PNKD Rabbit pAb
orb2709068-01 50 µL

PNKD Rabbit pAb

Sign In for Pricing
View Details
PNKD Rabbit pAb
orb2709068-02 100 µL

PNKD Rabbit pAb

Sign In for Pricing
View Details
Angptl7 siRNA (h)
sc-88201 10 µM

Angptl7 siRNA (h)

Sign In for Pricing
View Details
DGAT2 Antibody, Biotin conjugated
A64948-50UG 50 µg

DGAT2 Antibody, Biotin conjugated

Sign In for Pricing
View Details