Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKD3 Peptide - middle region

PRKD3 Peptide - middle region

Product Specifications

Product Name Alternative

EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU

UniProt

O94806

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFFLDPSDLDVERDEEAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV622756 1.0 µg DNA

CREB5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)
MBS1235284-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)
MBS1235284-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)
MBS1235284-03 0.02 mg (Yeast)

Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)
MBS1235284-04 0.1 mg (Yeast)

Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)
MBS1235284-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Small heat shock protein ibpA (ibpA)

Sign In for Pricing
View Details