Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHPK Peptide - middle region

SHPK Peptide - middle region

Product Specifications

Product Name Alternative

SHK, CARKL

UniProt

Q9UHJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037408.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin-1 Rabbit Monoclonal Antibody
E56G4553 100 µL

Caveolin-1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-AMY1 Antibody
YLD0409-01 50 µL

Rabbit anti-AMY1 Antibody

Sign In for Pricing
View Details
Rabbit anti-AMY1 Antibody
YLD0409-02 100 µL

Rabbit anti-AMY1 Antibody

Sign In for Pricing
View Details
Abracl Rat siRNA Oligo Duplex (Locus ID 685045)
SR508728 1 Kit

Abracl Rat siRNA Oligo Duplex (Locus ID 685045)

Sign In for Pricing
View Details
Cytokeratin 5 & 6 (RM341), RMab, 0.1mL Concentrate
MBS373177-01 0.1 mL (Concentrate)

Cytokeratin 5 & 6 (RM341), RMab, 0.1mL Concentrate

Sign In for Pricing
View Details
Cytokeratin 5 & 6 (RM341), RMab, 0.1mL Concentrate
MBS373177-02 3 mL (RTU)

Cytokeratin 5 & 6 (RM341), RMab, 0.1mL Concentrate

Sign In for Pricing
View Details