Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHPK Peptide - middle region

SHPK Peptide - middle region

Product Specifications

Product Name Alternative

SHK, CARKL

UniProt

Q9UHJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037408.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2G2 Polyclonal Antibody
E-AB-63385-01 60 µL

UBE2G2 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2G2 Polyclonal Antibody
E-AB-63385-02 120 µL

UBE2G2 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2G2 Polyclonal Antibody
E-AB-63385-03 200 µL

UBE2G2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-SPINK1 antibody
SLM-60323R-01 50 µL

Rabbit Anti-SPINK1 antibody

Sign In for Pricing
View Details
Rabbit Anti-SPINK1 antibody
SLM-60323R-02 100 µL

Rabbit Anti-SPINK1 antibody

Sign In for Pricing
View Details
Lentiviral human CCDC88A shRNA (UAS) - Lentiviral human CCDC88A shRNA (UAS, iRFP) plasmid
GTR15098944 1 Vial

Lentiviral human CCDC88A shRNA (UAS) - Lentiviral human CCDC88A shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details