Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIPL1 Peptide - middle region

AIPL1 Peptide - middle region

Product Specifications

Product Name Alternative

LCA4, AIPL2

UniProt

Q9NZN9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001028226.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADH4 (NM_000670) Human Over-expression Lysate
LY400219 100 µg

ADH4 (NM_000670) Human Over-expression Lysate

Sign In for Pricing
View Details
Vertical Autoclave BAVT-604-A
BAVT-604-A 1 Unit

Vertical Autoclave BAVT-604-A

Sign In for Pricing
View Details
MEK3 (MAP2K3) pSer189 Rabbit Polyclonal Antibody
AP01635PU-N 100 µg

MEK3 (MAP2K3) pSer189 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc39a12 Mouse Gene Knockout Kit (CRISPR)
KN516103 1 Kit

Slc39a12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM132E (NM_207313) Human Over-expression Lysate
LC404092 20 µg

TMEM132E (NM_207313) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FGF-16 Protein, His Tag
FG6-H51H3-100ug 100 µg

Human FGF-16 Protein, His Tag

Sign In for Pricing
View Details