Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBDD3 Peptide - C-terminal region

RHBDD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTAG, C22orf3, HS984G1A

UniProt

Q9Y3P4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036397.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malachite Green For Microscopy
01610 00100 100 g

Malachite Green For Microscopy

Sign In for Pricing
View Details
Lentiviral human GPALPP1 shRNA (UAS) - Lentiviral human GPALPP1 shRNA (UAS) plasmid
GTR15129823 1 Vial

Lentiviral human GPALPP1 shRNA (UAS) - Lentiviral human GPALPP1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human Osteoclast Associated Receptor (OSCAR) ELISA Kit
abx152597 96 Tests

Human Osteoclast Associated Receptor (OSCAR) ELISA Kit

Sign In for Pricing
View Details
SLC38A1 (NM_001278390) Human Tagged ORF Clone
RC238594 10 µg

SLC38A1 (NM_001278390) Human Tagged ORF Clone

Sign In for Pricing
View Details
SFXN5 Antibody
orb1559081-01 50 µL

SFXN5 Antibody

Sign In for Pricing
View Details
SFXN5 Antibody
orb1559081-02 100 µL

SFXN5 Antibody

Sign In for Pricing
View Details