DHRS7B Peptide - middle region
DHRS7B Peptide - middle region
Product Specifications
Product Name Alternative
CGI-93, SDR32C1
UniProt
Q6IAN0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_056325.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
D0967 96 Tests
Eosinophil Chemotactic Factor Receptor (ECFR) Mouse ELISA Kit
Sign In for Pricing
View Details 
MBS2021908-01 24 Strip Well
Rat Fibroblast Activation Protein Alpha (FAPa) ELISA Kit
Sign In for Pricing
View Details MBS2021908-02 48 Well
Rat Fibroblast Activation Protein Alpha (FAPa) ELISA Kit
Sign In for Pricing
View Details MBS2021908-03 96 Well
Rat Fibroblast Activation Protein Alpha (FAPa) ELISA Kit
Sign In for Pricing
View Details MBS2021908-04 5x 96 Well
Rat Fibroblast Activation Protein Alpha (FAPa) ELISA Kit
Sign In for Pricing
View Details MBS2021908-05 10x 96 Well
Rat Fibroblast Activation Protein Alpha (FAPa) ELISA Kit
Sign In for Pricing
View Details