Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM2 Peptide - C-terminal region

LRRTM2 Peptide - C-terminal region

Product Specifications

UniProt

O43300

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_056379.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRRIRQCSMVQNHRQLRSQTRLHMSNMSDQGPYNEYEPTHEGPFIIINGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymol (Standard)
HY-N6810R-01 10 mg

Thymol (Standard)

Sign In for Pricing
View Details
Thymol (Standard)
HY-N6810R-02 25 mg

Thymol (Standard)

Sign In for Pricing
View Details
Thymol (Standard)
HY-N6810R-03 50 mg

Thymol (Standard)

Sign In for Pricing
View Details
Thymol (Standard)
HY-N6810R-04 100 mg

Thymol (Standard)

Sign In for Pricing
View Details
PML-RARA-regulated adapter molecule 1
orb1637906-01 50 µg

PML-RARA-regulated adapter molecule 1

Sign In for Pricing
View Details
PML-RARA-regulated adapter molecule 1
orb1637906-02 100 µg

PML-RARA-regulated adapter molecule 1

Sign In for Pricing
View Details