Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM2 Peptide - C-terminal region

LRRTM2 Peptide - C-terminal region

Product Specifications

UniProt

O43300

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_056379.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRRIRQCSMVQNHRQLRSQTRLHMSNMSDQGPYNEYEPTHEGPFIIINGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-497-5p miRNA Agomir
orb1916832-01 5 nmol

Rno-miR-497-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-497-5p miRNA Agomir
orb1916832-02 10 nmol

Rno-miR-497-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-497-5p miRNA Agomir
orb1916832-03 20 nmol

Rno-miR-497-5p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)
MBS1339060-01 0.02 mg (E-Coli)

Recombinant Human Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)
MBS1339060-02 0.02 mg (Yeast)

Recombinant Human Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)
MBS1339060-03 0.02 mg (Baculovirus)

Recombinant Human Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)

Sign In for Pricing
View Details