Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1A2 Peptide - C-terminal region

OR1A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR17-6

UniProt

Q9Y585

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036484.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQKLFSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eph receptor A7 (EPHA7) Human Gene Knockout Kit (CRISPR)
KN426293 1 Kit

Eph receptor A7 (EPHA7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Genomic DNA, Kidney
CD563486 5 µg

Tissue Genomic DNA, Kidney

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF405S conjugate, 0.1mg/mL
BNC043433-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS716718 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Beclin 1 Rabbit Polyclonal Antibody
R1510-8 100 µL

Beclin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF36 (TRIM69) (Center) Rabbit Polyclonal Antibody
AP12251PU-N 400 µL

RNF36 (TRIM69) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details