Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1A2 Peptide - C-terminal region

OR1A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR17-6

UniProt

Q9Y585

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036484.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQKLFSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Congo Red *UltraPure grade* *CAS 573-58-0*
23056-AAT 100 mg

Congo Red *UltraPure grade* *CAS 573-58-0*

Sign In for Pricing
View Details
GPC6 Polyclonal Antibody
E-AB-16462-01 20 µL

GPC6 Polyclonal Antibody

Sign In for Pricing
View Details
GPC6 Polyclonal Antibody
E-AB-16462-02 60 µL

GPC6 Polyclonal Antibody

Sign In for Pricing
View Details
GPC6 Polyclonal Antibody
E-AB-16462-03 120 µL

GPC6 Polyclonal Antibody

Sign In for Pricing
View Details
GPC6 Polyclonal Antibody
E-AB-16462-04 200 µL

GPC6 Polyclonal Antibody

Sign In for Pricing
View Details
MMP-3 Recombinant Rabbit Monoclonal Antibody [JM46-22]
ET1705-98 100 µL

MMP-3 Recombinant Rabbit Monoclonal Antibody [JM46-22]

Sign In for Pricing
View Details