Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4E Peptide - middle region

CLEC4E Peptide - middle region

Product Specifications

Product Name Alternative

MINCLE, CLECSF9

UniProt

Q9ULY5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055173.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GAT3 Antibody
CQA5961-01 30 µL

Anti-GAT3 Antibody

Sign In for Pricing
View Details
Anti-GAT3 Antibody
CQA5961-02 50 μL

Anti-GAT3 Antibody

Sign In for Pricing
View Details
Anti-GAT3 Antibody
CQA5961-03 100 µL

Anti-GAT3 Antibody

Sign In for Pricing
View Details
Anti-GAT3 Antibody
CQA5961-04 200 µL

Anti-GAT3 Antibody

Sign In for Pricing
View Details
ERCC1 (NM_001166049) Human Tagged Lenti ORF Clone
RC228204L3 10 µg

ERCC1 (NM_001166049) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GABPB1 Rabbit pAb
E45R26924N-50 50 µL

GABPB1 Rabbit pAb

Sign In for Pricing
View Details