Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4E Peptide - middle region

CLEC4E Peptide - middle region

Product Specifications

Product Name Alternative

MINCLE, CLECSF9

UniProt

Q9ULY5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055173.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDA Polyclonal Antibody
A73461-100 100 µL

GDA Polyclonal Antibody

Sign In for Pricing
View Details
PCR Tube 8 Strip - white (Attached Cap)
KD484903-125 0.1 mL

PCR Tube 8 Strip - white (Attached Cap)

Sign In for Pricing
View Details
RERGL (NM_024730) Human Tagged ORF Clone Lentiviral Particle
RC206418L3V 200 µL

RERGL (NM_024730) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NPEPPS Human qPCR Template Standard (NM_006310)
HK209844 1 Kit

NPEPPS Human qPCR Template Standard (NM_006310)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit D (nuoD)
MBS1480162-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit D (nuoD)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit D (nuoD)
MBS1480162-02 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei NADH-quinone oxidoreductase subunit D (nuoD)

Sign In for Pricing
View Details