Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIBCH Peptide - C-terminal region

HIBCH Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIBYLCOAH

UniProt

Q6NVY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055177.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®740 Nanobody Thiol Labeling Kit, 1x (20-50ug) labeling
#92598 1 Kit

Mix-n-StainTM CF®740 Nanobody Thiol Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
TXNDC5 Antibody (Biotin)
KB-1329-01 50 μL

TXNDC5 Antibody (Biotin)

Sign In for Pricing
View Details
TXNDC5 Antibody (Biotin)
KB-1329-02 100 µL

TXNDC5 Antibody (Biotin)

Sign In for Pricing
View Details
TXNDC5 Antibody (Biotin)
KB-1329-03 1 mL

TXNDC5 Antibody (Biotin)

Sign In for Pricing
View Details
(AlphaR,BetaS)-rel-Bedaquiline-d6
TRC-B119557-5MG 5 mg

(AlphaR,BetaS)-rel-Bedaquiline-d6

Sign In for Pricing
View Details
Chrac1 (NM_053068) Mouse Tagged ORF Clone
MG200719 10 µg

Chrac1 (NM_053068) Mouse Tagged ORF Clone

Sign In for Pricing
View Details