Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIBCH Peptide - C-terminal region

HIBCH Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIBYLCOAH

UniProt

Q6NVY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055177.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS624179 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
MLC1 Polyclonal Antibody
E-AB-90506-01 60 µL

MLC1 Polyclonal Antibody

Sign In for Pricing
View Details
MLC1 Polyclonal Antibody
E-AB-90506-02 120 µL

MLC1 Polyclonal Antibody

Sign In for Pricing
View Details
MLC1 Polyclonal Antibody
E-AB-90506-03 200 µL

MLC1 Polyclonal Antibody

Sign In for Pricing
View Details
PCBP3 (NM_001130141) Human Over-expression Lysate
LC427177 20 µg

PCBP3 (NM_001130141) Human Over-expression Lysate

Sign In for Pricing
View Details
EEF1A2 (NM_001958) Human Over-expression Lysate
LC419596 20 µg

EEF1A2 (NM_001958) Human Over-expression Lysate

Sign In for Pricing
View Details