Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7A5 Peptide - C-terminal region

OR7A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTPCR2

UniProt

Q15622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_059976.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRALGIHLLWGTMKGQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENT2 Recombinant Antibody, Cy5.5 Conjugated
bsm-62135R-Cy5.5 100 µL

ENT2 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Neisseria lipooligosaccharide (LOS) Antibody (4C8) - GlcNAcbeta1-3Galbeta1-4glc1-4Hep
NBP2-75003 0.1 mL

Mouse Monoclonal Neisseria lipooligosaccharide (LOS) Antibody (4C8) - GlcNAcbeta1-3Galbeta1-4glc1-4Hep

Sign In for Pricing
View Details
PTAFR Antibody
orb25461-01 50 µg

PTAFR Antibody

Sign In for Pricing
View Details
PTAFR Antibody
orb25461-02 100 µg

PTAFR Antibody

Sign In for Pricing
View Details
FGF1 Antibody Blocking peptide
orb1447971 500 µg

FGF1 Antibody Blocking peptide

Sign In for Pricing
View Details
AP2A1 AAV Vector (Mouse) (CMV)
12106104 1 µg

AP2A1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details