What is the catalog number for OR7A5 Peptide - C-terminal region?

The catalog number for OR7A5 Peptide - C-terminal region is orb2001390.

What sizes are available for OR7A5 Peptide - C-terminal region?

OR7A5 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is OR7A5 Peptide - C-terminal region in stock?

OR7A5 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

OR7A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HTPCR2

UniProt

Q15622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_059976.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRALGIHLLWGTMKGQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-53122CL1 0.1 mL

Mouse Monoclonal Actin2 Antibody (mAb13a) [CoraFluor 1]

Sign In for Pricing

View Details

VAng-Cr4172-1mgEcoli 1 mg (E. coli)

Recombinant FAdV-1 FAdVAgp25 Protein (aa 1-131)

Sign In for Pricing

View Details

GSC-100B 1 Each

GenSolve DNA COMPLETE, extraction and DNA column purification for 100 DBS samples

Sign In for Pricing

View Details

32-3943-25 25 µg

HBZ Recombinant Protein

Sign In for Pricing

View Details

TL313794 1 Kit

Collagen IV (COL4A4) Human shRNA Plasmid Kit (Locus ID 1286)

Sign In for Pricing

View Details

MBS6000986-01 0.2 mL

DCC, ID (DCC, IGDCC1, Netrin receptor DCC, Colorectal cancer suppressor, Immunoglobulin superfamily DCC subclass member 1, Tumor suppressor protein DCC)

Sign In for Pricing

View Details