Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2J2 Peptide - C-terminal region

OR2J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR6-8, OR6-19, ORL684, OR6.3.8, hs6M1-6, dJ80I19.4

UniProt

O76002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112167.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRLLGWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E9]
TA502045BM 100 µL

Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E9]

Sign In for Pricing
View Details
PFDN3 (VBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]
TA504912AM 100 µL

PFDN3 (VBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Trifloxystrobin Acid
TRC-T138185-10MG 10 mg

Trifloxystrobin Acid

Sign In for Pricing
View Details
Recombinant Human CLPS/Colipase Protein (His Tag)
PKSH030591 100 µg

Recombinant Human CLPS/Colipase Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS636441 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Fgl1 (BC029734) Mouse Tagged ORF Clone
MG201613 10 µg

Fgl1 (BC029734) Mouse Tagged ORF Clone

Sign In for Pricing
View Details