Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2J2 Peptide - C-terminal region

OR2J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR6-8, OR6-19, ORL684, OR6.3.8, hs6M1-6, dJ80I19.4

UniProt

O76002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112167.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRLLGWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2'S)-Nicotine 1-Oxide
TRC-N428000-100MG 100 mg

(2'S)-Nicotine 1-Oxide

Sign In for Pricing
View Details
Human ZU5 (UNC5CL) activation kit by CRISPRa
GA116677 1 Kit

Human ZU5 (UNC5CL) activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Rat IL-10 (Interleukin 10) ELISA Kit
E-UNEL-R0023-01 5x 96 Tests

Uncoated Rat IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat IL-10 (Interleukin 10) ELISA Kit
E-UNEL-R0023-02 15x 96 Tests

Uncoated Rat IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
P2X2 (P2RX2) (NM_170683) Human Over-expression Lysate
LY430303 100 µg

P2X2 (P2RX2) (NM_170683) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559999 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details