Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC7 Peptide - N-terminal region

SIGLEC7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P75, QA79, AIRM1, CD328, CDw328, D-siglec, SIGLEC-7, SIGLECP2, SIGLEC19P, p75/AIRM1

UniProt

Q9Y286

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001264130.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ARF6 Antibody
RC-6859-01 50 μL

Recombinant ARF6 Antibody

Sign In for Pricing
View Details
Recombinant ARF6 Antibody
RC-6859-02 100 µL

Recombinant ARF6 Antibody

Sign In for Pricing
View Details
Recombinant ARF6 Antibody
RC-6859-03 1 mL

Recombinant ARF6 Antibody

Sign In for Pricing
View Details
Human Influenza Virus NS1A Binding Protein (IVNS1ABP) activation kit by CRISPRa
GA107276 1 Kit

Human Influenza Virus NS1A Binding Protein (IVNS1ABP) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710451 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant PUS1 Antibody
RC-5105-01 50 μL

Recombinant PUS1 Antibody

Sign In for Pricing
View Details