Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC7 Peptide - N-terminal region

SIGLEC7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P75, QA79, AIRM1, CD328, CDw328, D-siglec, SIGLEC-7, SIGLECP2, SIGLEC19P, p75/AIRM1

UniProt

Q9Y286

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001264130.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS506953 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Cdc20 (AR12), CF640R conjugate, 0.1mg/mL
BNC400672-100 1x 100 µL

Cdc20 (AR12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAP31 (BCAP31) (NM_001139441) Human Over-expression Lysate
LC427957 20 µg

BAP31 (BCAP31) (NM_001139441) Human Over-expression Lysate

Sign In for Pricing
View Details
CD4 (C4/206), CF647 conjugate, 0.1mg/mL
BNC470206-500 1x 500 µL

CD4 (C4/206), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rapeseed Oil
TRC-R800210-1ML 1 mL

Rapeseed Oil

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD268 Antibody[11C1]
AN00316M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD268 Antibody[11C1]

Sign In for Pricing
View Details