Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG4 Peptide - middle region

CACNG4 Peptide - middle region

Product Specifications

UniProt

Q9UBN1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055220.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF647 conjugate, 0.1mg/mL
BNC470810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9), CF®568 Conjugate - Biotium Choice
P016-568-125 1x 125 µL

CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymphoid tissue
CP565807 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details
Human Complement Component C5a, C-His Tag
HA210636-01 20 µg

Human Complement Component C5a, C-His Tag

Sign In for Pricing
View Details
Human Complement Component C5a, C-His Tag
HA210636-02 50 µg

Human Complement Component C5a, C-His Tag

Sign In for Pricing
View Details
Human Complement Component C5a, C-His Tag
HA210636-03 100 µg

Human Complement Component C5a, C-His Tag

Sign In for Pricing
View Details