Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG4 Peptide - middle region

CACNG4 Peptide - middle region

Product Specifications

UniProt

Q9UBN1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055220.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF13 Isoforms 1+3 (C-term) Goat Polyclonal Antibody
AP33112PU-N 100 µg

RNF13 Isoforms 1+3 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Stanniocalcin 2 (STC2) (N-term) Rabbit Polyclonal Antibody
AP11418PU-N 400 µL

Stanniocalcin 2 (STC2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Crip1 (NM_007763) Mouse Tagged ORF Clone
MG200117 10 µg

Crip1 (NM_007763) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MMP-12 Recombinant Rabbit monoclonal Antibody
HA750052 100 µL

MMP-12 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mucin 5AC Antibody
KC-24973-01 50 μL

Mucin 5AC Antibody

Sign In for Pricing
View Details
Mucin 5AC Antibody
KC-24973-02 100 µL

Mucin 5AC Antibody

Sign In for Pricing
View Details