Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK3 Peptide - middle region

DKK3 Peptide - middle region

Product Specifications

Product Name Alternative

RIG, REIC

UniProt

Q9UBP4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001018067.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3AP1 Antibody
KC-3471-01 50 μL

PIK3AP1 Antibody

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3471-02 100 µL

PIK3AP1 Antibody

Sign In for Pricing
View Details
PIK3AP1 Antibody
KC-3471-03 1 mL

PIK3AP1 Antibody

Sign In for Pricing
View Details
Human KDELR2 activation kit by CRISPRa
GA107564 1 Kit

Human KDELR2 activation kit by CRISPRa

Sign In for Pricing
View Details
USP39 antibody
FNab09332 100 µg

USP39 antibody

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR561822 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details