Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK3 Peptide - middle region

DKK3 Peptide - middle region

Product Specifications

Product Name Alternative

RIG, REIC

UniProt

Q9UBP4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001018067.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Demeton-S Sulfoxide
TRC-D231390-5MG 5 mg

Demeton-S Sulfoxide

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), 1mg/mL
BNUM1727-50 1x 50 µL

S100B (Astrocyte and Melanoma Marker), 1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD49d Antibody[R1-2]
AN00422J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD49d Antibody[R1-2]
AN00422J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD49d Antibody[R1-2]
AN00422J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
Recombinant S100 alpha6 Antibody
RC-6908-01 50 μL

Recombinant S100 alpha6 Antibody

Sign In for Pricing
View Details