Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTH4 Peptide - middle region

CYTH4 Peptide - middle region

Product Specifications

Product Name Alternative

CYT4, PSCD4, DJ63G5.1

UniProt

Q9UIA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037517.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Thyroid gland
CR560440 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
UEVLD Rabbit Polyclonal Antibody
TA383066 100 µL

UEVLD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS3 Polyclonal Antibody
E-AB-11431-01 20 µL

NDUFS3 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS3 Polyclonal Antibody
E-AB-11431-02 60 µL

NDUFS3 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS3 Polyclonal Antibody
E-AB-11431-03 120 µL

NDUFS3 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS3 Polyclonal Antibody
E-AB-11431-04 200 µL

NDUFS3 Polyclonal Antibody

Sign In for Pricing
View Details