Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYTH4 Peptide - middle region

CYTH4 Peptide - middle region

Product Specifications

Product Name Alternative

CYT4, PSCD4, DJ63G5.1

UniProt

Q9UIA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037517.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NADK Antibody
KC-11065-01 50 μL

NADK Antibody

Sign In for Pricing
View Details
NADK Antibody
KC-11065-02 100 µL

NADK Antibody

Sign In for Pricing
View Details
NADK Antibody
KC-11065-03 1 mL

NADK Antibody

Sign In for Pricing
View Details
OR8G1 Antibody
8G686-AAT 50 µg

OR8G1 Antibody

Sign In for Pricing
View Details
FSD1 Rabbit Polyclonal Antibody
TA370123 100 µL

FSD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACTR3 Antibody
8C14244-AAT 50 µg

ACTR3 Antibody

Sign In for Pricing
View Details