What is the catalog number for SIGLEC8 Peptide - middle region?

The catalog number for SIGLEC8 Peptide - middle region is orb2001381.

What sizes are available for SIGLEC8 Peptide - middle region?

SIGLEC8 Peptide - middle region is available in the following size(s): 100 µg.

Is SIGLEC8 Peptide - middle region in stock?

SIGLEC8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SIGLEC8 Peptide - middle region

Product Specifications

Product Name Alternative

SAF2, SIGLEC-8, SIGLEC8L

UniProt

Q9NYZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055257.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF805011 100 µg

HDAC4 Mouse Monoclonal Antibody [Clone ID: OTI6E6]

Sign In for Pricing

View Details

orb1696762 1 mg

KL044

Sign In for Pricing

View Details

35396061 1.0 µg DNA

OR5AZ1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

038061 200 µL

MAFB, CT (MAFB, KRML, Transcription factor MafB, V-maf musculoaponeurotic fibrosarcoma oncogene homolog B)

Sign In for Pricing

View Details

HY-P77825-01 20 µg

ROR1, Canine (HEK293, His)

Sign In for Pricing

View Details

HY-P77825-02 50 µg

ROR1, Canine (HEK293, His)

Sign In for Pricing

View Details