SIGLEC8 Peptide - middle region
SIGLEC8 Peptide - middle region
Product Specifications
Product Name Alternative
SAF2, SIGLEC-8, SIGLEC8L
UniProt
Q9NYZ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_055257.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M9761-03 100 µg
MYF6 (Myogenic Factor 6, Myf-6, Class C Basic Helix-loop-helix Protein 4, bHLHc4, Muscle-specific Regulatory Factor 4, BHLHC4, MRF4)
Sign In for Pricing
View Details MBS7098022 Inquire
Recombinant Cephalophus spadix Cytochrome b (MT-CYB), partial
Sign In for Pricing
View Details MBS6213094-01 0.1 mL
Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (MaxLight 550)
Sign In for Pricing
View Details MBS6213094-02 5x 0.1 mL
Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (MaxLight 550)
Sign In for Pricing
View Details ED0205Hu-01 96 Well
Human mycoplasma pneumoniae antibody IgM, MP Ab IgM ELISA KIT
Sign In for Pricing
View Details