What is the catalog number for GNMT Peptide - middle region?

The catalog number for GNMT Peptide - middle region is orb2001380.

What sizes are available for GNMT Peptide - middle region?

GNMT Peptide - middle region is available in the following size(s): 100 µg.

Is GNMT Peptide - middle region in stock?

GNMT Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GNMT Peptide - middle region

Product Specifications

UniProt

Q14749

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_061833.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-00002H 0.1 mL

Rabbit Polyclonal BNIP3L Antibody [HRP]

Sign In for Pricing

View Details

K4135501 3x 1.0 µg

Olfr205 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing

View Details

bs-4157R-PE 100 µL

PRKD3 Polyclonal Antibody, PE Conjugated

Sign In for Pricing

View Details

abx951394-01 150 µg

Human EMP2 shRNA Plasmid

Sign In for Pricing

View Details

abx951394-02 300 µg

Human EMP2 shRNA Plasmid

Sign In for Pricing

View Details

OR1049092-01 100 mg

5- (1,3-Dithiolan-2-yl) -1- ((2R,4S,5R) -4-hydroxy-5- (hydroxymethyl) tetrahydrofuran-2-yl) pyrimidine-2,4 (1H,3H) -dione

Sign In for Pricing

View Details