Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACSIN3 Peptide - middle region

PACSIN3 Peptide - middle region

Product Specifications

Product Name Alternative

SDPIII

UniProt

Q9UKS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001171903.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPQSPGSPGTGQDEEWSDEESPRKAATGVRVRALYDYAGQEADELSFRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzothiazol-2-yl- (2-ethoxy-phenyl) -amine
sc-353029 1 g

Benzothiazol-2-yl- (2-ethoxy-phenyl) -amine

Sign In for Pricing
View Details
TCP1 alpha Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-12292R-APC-Cy5.5 100 µL

TCP1 alpha Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Ubc9 (Ubiquitin-Conjugating Enzyme 9) (MaxLight 490)
U0880-03-ML490 100 µL

Ubc9 (Ubiquitin-Conjugating Enzyme 9) (MaxLight 490)

Sign In for Pricing
View Details
PcDNA3.1-HAVCR2
BZ0955-1 1 Vial

PcDNA3.1-HAVCR2

Sign In for Pricing
View Details
Lentiviral mouse Gins3 shRNA (UAS) - Lentiviral mouse Gins3 shRNA (UAS) plasmid
GTR15143899 1 Vial

Lentiviral mouse Gins3 shRNA (UAS) - Lentiviral mouse Gins3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-TSPYL5 Antibody Picoband® Fluoro550 Conjugated
A10648-2-Fluoro550 100 µg/Vial

Anti-TSPYL5 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details