Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACSIN3 Peptide - middle region

PACSIN3 Peptide - middle region

Product Specifications

Product Name Alternative

SDPIII

UniProt

Q9UKS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001171903.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPQSPGSPGTGQDEEWSDEESPRKAATGVRVRALYDYAGQEADELSFRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Monoclonal Antibody
MBS2580033-01 0.1 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details
EGFR Monoclonal Antibody
MBS2580033-02 0.2 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details
EGFR Monoclonal Antibody
MBS2580033-03 1 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details
EGFR Monoclonal Antibody
MBS2580033-04 5x 1 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details
2-ethyl-1- (5-methoxy-2-methylphenyl) butan-1-ol
OR1090856-01 250 mg

2-ethyl-1- (5-methoxy-2-methylphenyl) butan-1-ol

Sign In for Pricing
View Details
2-ethyl-1- (5-methoxy-2-methylphenyl) butan-1-ol
OR1090856-02 500 mg

2-ethyl-1- (5-methoxy-2-methylphenyl) butan-1-ol

Sign In for Pricing
View Details