Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD3 Peptide - N-terminal region

TMOD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UTMOD

UniProt

Q9NYL9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055362.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETELKQLETVLDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLLSYLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-1 Double Nickase Plasmid (h2)
sc-417320-NIC-2 20 µg

Caspase-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
FOLR1 Recombinant Protein
96-995 0.1 mg

FOLR1 Recombinant Protein

Sign In for Pricing
View Details
GLS2 Rabbit pAb
orb2708214-01 50 µL

GLS2 Rabbit pAb

Sign In for Pricing
View Details
GLS2 Rabbit pAb
orb2708214-02 100 µL

GLS2 Rabbit pAb

Sign In for Pricing
View Details
ANAPC2 (Anaphase-promoting Complex Subunit 2, APC2, Cyclosome Subunit 2, ANAPC2, APC2, KIAA1406) (MaxLight 405) discontinued
302264-ML405 100 µL

ANAPC2 (Anaphase-promoting Complex Subunit 2, APC2, Cyclosome Subunit 2, ANAPC2, APC2, KIAA1406) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Polyclonal IRS1 Antibody (aa289-338)
APR08044G 0.05ml

Polyclonal IRS1 Antibody (aa289-338)

Sign In for Pricing
View Details