Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD3 Peptide - N-terminal region

TMOD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UTMOD

UniProt

Q9NYL9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055362.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETELKQLETVLDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLLSYLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prdx5 (NM_012021) Mouse Tagged Lenti ORF Clone
MR224040L4 10 µg

Prdx5 (NM_012021) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OPA3 Antibody
MBS8503679-01 0.1 mg

OPA3 Antibody

Sign In for Pricing
View Details
OPA3 Antibody
MBS8503679-02 0.1 mL (AF405L)

OPA3 Antibody

Sign In for Pricing
View Details
OPA3 Antibody
MBS8503679-03 0.1 mL (AF405S)

OPA3 Antibody

Sign In for Pricing
View Details
OPA3 Antibody
MBS8503679-04 0.1 mL (AF610)

OPA3 Antibody

Sign In for Pricing
View Details
OPA3 Antibody
MBS8503679-05 0.1 mL (AF635)

OPA3 Antibody

Sign In for Pricing
View Details