Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVB Peptide - N-terminal region

PARVB Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGI-56

UniProt

Q9HBI1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001003828.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJA1 Polyclonal Antibody
E-AB-18224-01 20 µL

GJA1 Polyclonal Antibody

Sign In for Pricing
View Details
GJA1 Polyclonal Antibody
E-AB-18224-02 60 µL

GJA1 Polyclonal Antibody

Sign In for Pricing
View Details
GJA1 Polyclonal Antibody
E-AB-18224-03 120 µL

GJA1 Polyclonal Antibody

Sign In for Pricing
View Details
GJA1 Polyclonal Antibody
E-AB-18224-04 200 µL

GJA1 Polyclonal Antibody

Sign In for Pricing
View Details
Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI8B5]
CF807959 100 µg

Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI8B5]

Sign In for Pricing
View Details
Octahydro-1H-pyrrolo[3,4-b]pyridine-d2 Di-trifluoroacetate
TRC-O236512-25MG 25 mg

Octahydro-1H-pyrrolo[3,4-b]pyridine-d2 Di-trifluoroacetate

Sign In for Pricing
View Details