Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT7 Peptide - C-terminal region

CNOT7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAF1, Caf1a, hCAF-1

UniProt

Q9UIV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037486.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIF21A activation kit by CRISPRa
GA110816 1 Kit

Human KIF21A activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS716923 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Rabbit Polyclonal Antibody
AP06613PU-N 100 µg

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vitamin K1-18O(Mixture of 1-18O and 4-18O)
TRC-V676082-1MG 1 mg

Vitamin K1-18O(Mixture of 1-18O and 4-18O)

Sign In for Pricing
View Details
CCS Machine (Manual sampling) BPTL-109
BPTL-109 1 Unit

CCS Machine (Manual sampling) BPTL-109

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2461), CF568 conjugate, 0.1mg/mL
BNC682461-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2461), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details